PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA5G00078
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 245aa    MW: 28005 Da    PI: 5.4824
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA5G00078genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53.2e-131565148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+   +  G++   +W+ +++   ++R++k+c++rw +yl
        AA5G00078 15 KGPWTAEEDKKLIAFLRTRGNEggwCWRDVPKVAELRRCGKSCRLRWTNYL 65
                     79***********************************************97 PP

2Myb_DNA-binding51.72e-1671115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T +E +l +d++++lG++ W++Ia++++ gRt++++k++w+++
        AA5G00078  71 RGLFTDDEVKLVLDLHARLGNR-WSKIAAKLP-GRTDNDIKNYWNTH 115
                      7889******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-17768IPR009057Homeodomain-like
PROSITE profilePS5129412.921065IPR017930Myb domain
SuperFamilySSF466897.11E-2412112IPR009057Homeodomain-like
SMARTSM007175.8E-81467IPR001005SANT/Myb domain
PfamPF002493.5E-121565IPR001005SANT/Myb domain
CDDcd001675.97E-61765No hitNo description
PROSITE profilePS5129426.366120IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2569121IPR009057Homeodomain-like
SMARTSM007171.4E-1570118IPR001005SANT/Myb domain
PfamPF002491.1E-1471115IPR001005SANT/Myb domain
CDDcd001674.98E-1174116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRRKSCSDE IGLRKGPWTA EEDKKLIAFL RTRGNEGGWC WRDVPKVAEL RRCGKSCRLR  60
WTNYLRPDLK RGLFTDDEVK LVLDLHARLG NRWSKIAAKL PGRTDNDIKN YWNTHIKRKL  120
IRLGIDPRTH HRFDQQKVNE NDEEEERLVN GQDPPVEPEA SFVSNQEINT SAELNQNLSG  180
NVDGDDQPWS FLMENDGEGS AGDGELRILF SGDINSSSSS SNASSLWSKF GDFGYQDLEF  240
GRFDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27131205108B-MYB
1h8a_C1e-261312025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00577DAPTransfer from AT5G62320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010483899.11e-114PREDICTED: protein ODORANT1-like
SwissprotQ50EX64e-67ODO1_PETHY; Protein ODORANT1
TrEMBLA0A078DCE91e-114A0A078DCE9_BRANA; BnaC03g51750D protein
STRINGscaffold_802887.11e-106(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62320.11e-105myb domain protein 99